Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR122W  from Saccharomyces cerevisiae S288C
>YHR122W|YHR122W YHR122W SGDID:S000001164, Chr VIII from 353625-354320, Genome Release 64-1-1, Verified ORF, "Protein of unknown function required for establishment of sister chromatid cohesion; synthetically lethal with RFC5, an RF-C subunit that links replication to cohesion establishment; YHR122W is an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (231 aa)
MSEFLNENPDILEENQLPTRKEDSTKDLLLGGFSNEATLERRSLLLKIDHSLKSQVLQDI
EVLDKLLSIRIPPELTSDEDSLPAESEDESVAGGGKEEEEPDLIDAQEIYDLIAHISDPE
HPLSLGQLSVVNLEDIDVHDSGNQNEMAEVVIKITPTITHCSLATLIGLGIRVRLERSLP
PRFRITILLKKGTHDSENQVNKQLNDKERVAAACENEQLLGVVSKMLVTCK