Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR121W  from Saccharomyces cerevisiae S288C
>YHR121W|YHR121W LSM12 SGDID:S000001163, Chr VIII from 352756-353319, Genome Release 64-1-1, Verified ORF, "Protein of unknown function that may function in RNA processing; interacts with Pbp1p and Pbp4p and associates with ribosomes; contains an RNA-binding LSM domain and an AD domain; GFP-fusion protein is induced by the DNA-damaging agent MMS" ORGANISM: Saccharomyces cerevisiae S288C (187 aa)
MSVSLEQTLGFRIKVTNVLDVVTEGRLYSFNSSNNTLTIQTTKKNQSPQNFKVIKCTFIK
HLEVIGDKPSFNSFKKQQIKPSYVNVERVEKLLKESVIASKKKELLRGKGVSAEGQFIFD
QIFKTIGDTKWVAKDIIILDDVKVQPPYKVEDIKVLHEGSNQSITLIQRIVERSWEQLEQ
DDGRKGG