Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR116W  from Saccharomyces cerevisiae S288C
>YHR116W|YHR116W COX23 SGDID:S000001158, Chr VIII from 341665-342120, Genome Release 64-1-1, Verified ORF, "Mitochondrial intermembrane space protein that functions in mitochondrial copper homeostasis, essential for functional cytochrome oxidase expression; homologous to Cox17p; contains twin cysteine-x9-cysteine motifs" ORGANISM: Saccharomyces cerevisiae S288C (151 aa)
MEKPSPTRRQTSSLSTISNGMTMTNDNRDTTNTNSGSTSSNNSQPSSSSTPPAASGPVTD
RTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERNDY
DRSKCQEYFDAYRECKKQWLTARRKNRQQWE