Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR081W  from Saccharomyces cerevisiae S288C
>YHR081W|YHR081W LRP1 SGDID:S000001123, Chr VIII from 267538-268092, Genome Release 64-1-1, Verified ORF, "Nuclear exosome-associated nucleic acid binding protein; involved in RNA processing, surveillance, degradation, tethering, and export; homolog of mammalian nuclear matrix protein C1D involved in regulation of DNA repair and recombination" ORGANISM: Saccharomyces cerevisiae S288C (184 aa)
MEDIEKIKPYVRSFSKALDELKPEIEKLTSKSLDEQLLLLSDERAKLELINRYAYVLSSL
MFANMKVLGVKDMSPILGELKRVKSYMDKAKQYDNRITKSNEKSQAEQEKAKNIISNVLD
GNKNQFEPSISRSNFQGKHTKFENDELAESTTTKIIDSTDHIRKASSKKSKRLDKVGKKK
GGKK