Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR079C-A  from Saccharomyces cerevisiae S288C
>YHR079C-A|YHR079C-A SAE3 SGDID:S000001957, Chr VIII from 262354-262192,262553-262441, Genome Release 64-1-1, reverse complement, Verified ORF, "Meiosis specific protein involved in DMC1-dependent meiotic recombination, forms heterodimer with Mei5p; proposed to be an assembly factor for Dmc1p" ORGANISM: Saccharomyces cerevisiae S288C (91 aa)
MNYLETQLNKKQKQIQEYESMNGNLIKMFEQLSKEKKNDETPKKISSTYIKELKEYNELR
DAGLRLAQIIADEKQCKIKDVFEEIGYSMKD