Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR072W-A  from Saccharomyces cerevisiae S288C
>YHR072W-A|YHR072W-A NOP10 SGDID:S000007455, Chr VIII from 241664-241840, Genome Release 64-1-1, Verified ORF, "Constituent of small nucleolar ribonucleoprotein particles containing H/ACA-type snoRNAs, which are required for pseudouridylation and processing of pre-18S rRNA" ORGANISM: Saccharomyces cerevisiae S288C (58 aa)
MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ