Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR055C  from Saccharomyces cerevisiae S288C
>YHR055C|YHR055C CUP1-2 SGDID:S000001097, Chr VIII from 214718-214533, Genome Release 64-1-1, reverse complement, Verified ORF, "Metallothionein, binds copper and mediates resistance to high concentrations of copper and cadmium; locus is variably amplified in different strains, with two copies, CUP1-1 and CUP1-2, in the genomic sequence reference strain S288C" ORGANISM: Saccharomyces cerevisiae S288C (61 aa)
MFSELINFQNEGHECQCQCGSCKNNEQCQKSCSCPTGCNSDDKCPCGNKSEETKKSCCSG
K