>YHR053C|YHR053C CUP1-1 SGDID:S000001095, Chr VIII from 212720-212535, Genome Release 64-1-1, reverse complement, Verified ORF, "Metallothionein, binds copper and mediates resistance to high concentrations of copper and cadmium; locus is variably amplified in different strains, with two copies, CUP1-1 and CUP1-2, in the genomic sequence reference strain S288C" ORGANISM: Saccharomyces cerevisiae S288C (61 aa)
MFSELINFQNEGHECQCQCGSCKNNEQCQKSCSCPTGCNSDDKCPCGNKSEETKKSCCSG
K