Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR051W  from Saccharomyces cerevisiae S288C
>YHR051W|YHR051W COX6 SGDID:S000001093, Chr VIII from 209705-210151, Genome Release 64-1-1, Verified ORF, "Subunit VI of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain; expression is regulated by oxygen levels" ORGANISM: Saccharomyces cerevisiae S288C (148 aa)
MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFEEFTARYEKEF
DEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDLPTAIRVFEALKYKVENEDQ
YKAYLDELKDVRQELGVPLKEELFPSSS