Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR039C-A  from Saccharomyces cerevisiae S288C
>YHR039C-A|YHR039C-A VMA10 SGDID:S000002100, Chr VIII from 187514-187173,187679-187677, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit G of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; involved in vacuolar acidification" ORGANISM: Saccharomyces cerevisiae S288C (114 aa)
MSQKNGIATLLQAEKEAHEIVSKARKYRQDKLKQAKTDAAKEIDSYKIQKDKELKEFEQK
NAGGVGELEKKAEAGVQGELAEIKKIAEKKKDDVVKILIETVIKPSAEVHINAL