Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR021C  from Saccharomyces cerevisiae S288C
>YHR021C|YHR021C RPS27B SGDID:S000001063, Chr VIII from 148116-147871,148669-148667, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps27Ap and has similarity to rat S27 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (82 aa)
MVLVQDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQTAVTCESCS
TVLCTPTGGKAKLSEGTSFRRK