Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR010W  from Saccharomyces cerevisiae S288C
>YHR010W|YHR010W RPL27A SGDID:S000001052, Chr VIII from 126521-126551,127113-127492, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl27Bp and has similarity to rat L27 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (136 aa)
MAKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGSKSHPFGHALVAGIERYPLKVTKKHGAK
KVAKRTKIKPFIKVVNYNHLLPTRYTLDVEAFKSVVSTETFEQPSQREEAKKVVKKAFEE
RHQAGKNQWFFSKLRF