Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YHR007C-A  from Saccharomyces cerevisiae S288C
>YHR007C-A|YHR007C-A YHR007C-A SGDID:S000028830, Chr VIII from 122765-122550, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry" ORGANISM: Saccharomyces cerevisiae S288C (71 aa)
MHRKKRKKEKKRTEKDNTTNLPPLFLFPCSLSLPTLLAPVHYIPTRLTHHQAENQLFLLL
FQPIIVKPLRS