Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR005C-A  from Saccharomyces cerevisiae S288C
>YHR005C-A|YHR005C-A TIM10 SGDID:S000003530, Chr VIII from 115901-115620, Genome Release 64-1-1, reverse complement, Verified ORF, "Essential protein of the mitochondrial intermembrane space, forms a complex with Tim9p (TIM10 complex) that delivers hydrophobic proteins to the TIM22 complex for insertion into the inner membrane" ORGANISM: Saccharomyces cerevisiae S288C (93 aa)
MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESS
CLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF