Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHR001W-A  from Saccharomyces cerevisiae S288C
>YHR001W-A|YHR001W-A QCR10 SGDID:S000003529, Chr VIII from 107826-107831,107895-108122, Genome Release 64-1-1, Verified ORF, "Subunit of the ubiqunol-cytochrome c oxidoreductase complex which includes Cobp, Rip1p, Cyt1p, Cor1p, Qcr2p, Qcr6p, Qcr7p, Qcr8p, Qcr9p, and Qcr10p and comprises part of the mitochondrial respiratory chain" ORGANISM: Saccharomyces cerevisiae S288C (77 aa)
MAYTSHLSSKTGLHFGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQDTLYKKIP
LLGPTLEDHTPPEDKPN