Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHL042W  from Saccharomyces cerevisiae S288C
>YHL042W|YHL042W YHL042W SGDID:S000001034, Chr VIII from 15667-16119, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; member of the DUP380 subfamily of conserved, often subtelomerically-encoded proteins" ORGANISM: Saccharomyces cerevisiae S288C (150 aa)
MKQRFSQVATVIFFVMSIRSPRNLGFFFTLALFVVLVCSQEWFSFEMNRSCSMKVEHRMQ
FLSTIISEHQKSDVNCWDQIAKKMNVYLFEQKVSGSDVFFLDGADCERFFERNFLRYLPS
RKSSHPDLPIAELLPYIRKADIACAGKQLI