Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHL015W  from Saccharomyces cerevisiae S288C
>YHL015W|YHL015W RPS20 SGDID:S000001007, Chr VIII from 75412-75777, Genome Release 64-1-1, Verified ORF, "Protein component of the small (40S) ribosomal subunit; overproduction suppresses mutations affecting RNA polymerase III-dependent transcription; has similarity to E. coli S10 and rat S20 ribosomal proteins" ORGANISM: Saccharomyces cerevisiae S288C (121 aa)
MSDFQKEKVEEQEQQQQQIIKIRITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPT
KVLKISTRKTPNGEGSKTWETYEMRIHKRYIDLEAPVQIVKRITQITIEPGVDVEVVVAS
N