Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHL006C  from Saccharomyces cerevisiae S288C
>YHL006C|YHL006C SHU1 SGDID:S000000998, Chr VIII from 98795-98343, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein involved in a Rad51p-, Rad54p-dependent pathway for homologous recombination repair, important for error-free repair of spontaneous and induced DNA lesions to protect the genome from mutation; associates with Shu2p, Psy3p, and Csm2p" ORGANISM: Saccharomyces cerevisiae S288C (150 aa)
MQFEERLQQLVESDWSLDQSSPNVLVIVLGDTARKYVELGGLKEHVTTNTVAGHVASRER
VSVVFLGRVKYLYMYLTRMQAQANGPQYSNVLVYGLWDLTATQDGPQQLRLLSLVLRQCL
SLPSKVEFYPEPPSSSVPARLLRFWDHIIR