Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YHL001W  from Saccharomyces cerevisiae S288C
>YHL001W|YHL001W RPL14B SGDID:S000000993, Chr VIII from 104277-104405,104804-105091, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl14Ap and has similarity to rat L14 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (138 aa)
MSTDSIVKASNWRLVEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKAGVPRQAINL
GQVVLTPLTFALPRGARTATVSKKWAAAGVCEKWAASSWAKKIAQRERRAALTDFERFQV
MVLRKQKRYTVKKALAKA