Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR275W  from Saccharomyces cerevisiae S288C
>YGR275W|YGR275W RTT102 SGDID:S000003507, Chr VII from 1043276-1043749, Genome Release 64-1-1, Verified ORF, "Component of both the SWI/SNF and RSC chromatin remodeling complexes, suggested role in chromosome maintenance; possible weak regulator of Ty1 transposition" ORGANISM: Saccharomyces cerevisiae S288C (157 aa)
MDPQTLITKANKVSYYGNPTSKESWRYDWYQPSKVSSNVQQPQQQLGDMENNLEKYPFRY
KTWLRNQEDEKNLQRESCEDILDLKEFDRRILKKSLMTSHTKGDTSKATGAPSANQGDEA
LSVDDIRGAVGNSEAIPGLSAGVNNDNTKESKDVKMN