Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR273C  from Saccharomyces cerevisiae S288C
>YGR273C|YGR273C YGR273C SGDID:S000003505, Chr VII from 1039239-1038715, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; expression downregulated by treatment with 8-methoxypsoralen plus UVA irradiation; YGR273C is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (174 aa)
MQHFESSDKIEKDDDTSRIKLRSSSLAAPILEAVQEAQPFEEATFSNLQKIHPLTENSTC
NGYVIYDKDGNLKSMKDTFGRNIKTPDISNPTRARNERPLDTIRGFEYSITKDPRWLQEL
ETSKLGFKPRPGFAVINQDSQASINLSQLEEKVMESQKKKEKRHISRLSRLLCR