Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR268C  from Saccharomyces cerevisiae S288C
>YGR268C|YGR268C HUA1 SGDID:S000003500, Chr VII from 1026653-1026057, Genome Release 64-1-1, reverse complement, Verified ORF, "Cytoplasmic protein containing a zinc finger domain with sequence similarity to that of Type I J-proteins; computational analysis of large-scale protein-protein interaction data suggests a possible role in actin patch assembly" ORGANISM: Saccharomyces cerevisiae S288C (198 aa)
MSKDTHDDELPSYEDVIKEEERLQSQPPRPPRPAANLAQGHQSRPHQRPSTMPATSSSQT
YAHSHSYTPTSSQPRPPPRPQQNPSLPWTYPPRFYCSKCGNTGYKLKNGRSCKSCWRRFA
PQNNVVSAPTYYTNYTMPVYTNAWQGNRPLYVQPGDPRLGGVLCGECRGSGRTRFLLDED
ICPLCHGVGRIITQPQRY