Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR243W  from Saccharomyces cerevisiae S288C
>YGR243W|YGR243W FMP43 SGDID:S000003475, Chr VII from 977336-977776, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; expression regulated by osmotic and alkaline stresses; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies" ORGANISM: Saccharomyces cerevisiae S288C (146 aa)
MSASAFNFAFRRFWNSETGPKTVHFWAPTLKWGLVFAGLNDIKRPVEKVSGAQNLSLLAT
ALIWTRWSFVIKPKNYLLASVNFFLGCTAGYHLTRIANFRIRNGDSFKQVIHYIIKGETP
AAVAAKQTASTSMNKGVIGTNPPITH