Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR236C  from Saccharomyces cerevisiae S288C
>YGR236C|YGR236C SPG1 SGDID:S000003468, Chr VII from 962817-962530, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein required for survival at high temperature during stationary phase; not required for growth on nonfermentable carbon sources; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies" ORGANISM: Saccharomyces cerevisiae S288C (95 aa)
MKLDSGIYSEAQRVVRTPKFRYIMLGLVGAAVVPTAYMRRGYTVPAHSLDNINGVDTTKA
SVMGTEQRAAMTKGKSLQEMMDDDEVTYLMFSSIM