Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YGR215W  from Saccharomyces cerevisiae S288C
>YGR215W|YGR215W RSM27 SGDID:S000003447, Chr VII from 922175-922507, Genome Release 64-1-1, Verified ORF, "Mitochondrial ribosomal protein of the small subunit" ORGANISM: Saccharomyces cerevisiae S288C (110 aa)
MNVPKARLLKVAELSAKIFDQNFNPSGIRTGSKILNERLKGPSVASYYGNPDILKFRHLK
TLYPDIEFVDLEEQYRLSMVEAKKRRGKGAPKKMKKDAAATAKGKGKKKK