Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR209C  from Saccharomyces cerevisiae S288C
>YGR209C|YGR209C TRX2 SGDID:S000003441, Chr VII from 913227-912913, Genome Release 64-1-1, reverse complement, Verified ORF, "Cytoplasmic thioredoxin isoenzyme of the thioredoxin system which protects cells against oxidative and reductive stress, forms LMA1 complex with Pbi2p, acts as a cofactor for Tsa1p, required for ER-Golgi transport and vacuole inheritance" ORGANISM: Saccharomyces cerevisiae S288C (104 aa)
MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDE
VSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV