Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR206W  from Saccharomyces cerevisiae S288C
>YGR206W|YGR206W MVB12 SGDID:S000003438, Chr VII from 910432-910737, Genome Release 64-1-1, Verified ORF, "ESCRT-I subunit required to stabilize oligomers of the ESCRT-I core complex (Stp22p, Vps28p, Srn2p), which is involved in ubiquitin-dependent sorting of proteins into the endosome; deletion mutant is sensitive to rapamycin and nystatin" ORGANISM: Saccharomyces cerevisiae S288C (101 aa)
MNNNVEELLRRIPLYNKYGKDFPQETVTRFQMPEFKLPALQPTRDLLCPWYEECDNITKV
CQLHDSSNKKFDQWYKEQYLSKKPPGIVGNTLLSPSRKDNS