Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR204C-A  from Saccharomyces cerevisiae S288C
>YGR204C-A|YGR204C-A YGR204C-A SGDID:S000028640, Chr VII from 909174-909061, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (37 aa)
MQWNAFSFVSYVYLRYFISFRPNIVLASVRLSWYSII