Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR203W  from Saccharomyces cerevisiae S288C
>YGR203W|YGR203W YCH1 SGDID:S000003435, Chr VII from 905237-905683, Genome Release 64-1-1, Verified ORF, "Phosphatase with sequence similarity to Cdc25p, Arr2p and Mih1p; member of the single-domain rhodanese homology superfamily; green fluorescent protein (GFP)-fusion protein localizes to both the cytoplasm and the nucleus" ORGANISM: Saccharomyces cerevisiae S288C (148 aa)
MDSYSITNVKYLDPTELHRWMQEGHTTTLREPFQVVDVRGSDYMGGHIKDGWHYAYSRLK
QDPEYLRELKHRLLEKQADGRGALNVIFHCMLSQQRGPSAAMLLLRSLDTAELSRCRLWV
LRGGFSRWQSVYGDDESVTAGYLPDLWR