Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR183C  from Saccharomyces cerevisiae S288C
>YGR183C|YGR183C QCR9 SGDID:S000003415, Chr VII from 859260-859063,859476-859474, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit 9 of the ubiquinol cytochrome-c reductase complex, which is a component of the mitochondrial inner membrane electron transport chain; required for electron transfer at the ubiquinol oxidase site of the complex" ORGANISM: Saccharomyces cerevisiae S288C (66 aa)
MSFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAAGD
GDDDDE