Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR181W  from Saccharomyces cerevisiae S288C
>YGR181W|YGR181W TIM13 SGDID:S000003413, Chr VII from 858287-858604, Genome Release 64-1-1, Verified ORF, "Mitochondrial intermembrane space protein, forms a complex with Tim8p that delivers a subset of hydrophobic proteins to the TIM22 complex for insertion into the inner membrane" ORGANISM: Saccharomyces cerevisiae S288C (105 aa)
MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELVNKISENCFEK
CLTSPYATRNDACIDQCLAKYMRSWNVISKAYISRIQNASASGEI