Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR174C  from Saccharomyces cerevisiae S288C
>YGR174C|YGR174C CBP4 SGDID:S000003406, Chr VII from 846405-845893, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial protein required for assembly of cytochrome bc1 complex; interacts with the Cbp3p-Cbp6p complex and newly synthesized cytochrome b (Cobp) to promote assembly of Cobp into the cytochrome bc1 complex" ORGANISM: Saccharomyces cerevisiae S288C (170 aa)
MQCAITPREAVIAKQRQYKHYLGMERPLWVRWLKVYAIGGAIIGSGFLLFKYTTPTDQQL
ISQLSPELRLQYEREKKLRQSEQQALMKIVKETSQSDDPIWKTGPLQSPWERNGDNVQSR
DHFAKVRAEEVQKEELARIRNELSQLRSETEEKTKEIVQDKQVKSWWRFW