Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR167W  from Saccharomyces cerevisiae S288C
>YGR167W|YGR167W CLC1 SGDID:S000003399, Chr VII from 832456-833157, Genome Release 64-1-1, Verified ORF, "Clathrin light chain, subunit of the major coat protein involved in intracellular protein transport and endocytosis; thought to regulate clathrin function; two Clathrin heavy chains (CHC1) form the clathrin triskelion structural component" ORGANISM: Saccharomyces cerevisiae S288C (233 aa)
MSEKFPPLEDQNIDFTPNDKKDDDTDFLKREAEILGDEFKTEQDDILETEASPAKDDDEI
RDFEEQFPDINSANGAVSSDQNGSATVSSGNDNGEADDDFSTFEGANQSTESVKEDRSEV
VDQWKQRRAVEIHEKDLKDEELKKELQDEAIKHIDDFYDSYNKKKEQQLEDAAKEAEAFL
KKRDEFFGQDNTTWDRALQLINQDDADIIGGRDRSKLKEILLRLKGNAKAPGA