Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YGR161W-C  from Saccharomyces cerevisiae S288C
>YGR161W-C|YGR161W-C YGR161W-C SGDID:S000029726, Chr VII from 810227-810505, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by sequence comparison with hemiascomycetous yeast species" ORGANISM: Saccharomyces cerevisiae S288C (92 aa)
MSGYFNHLSSNAHFANIQADQGFIGDATGTSSDHGSSGMVDFALQLGELSLEEKILKEFT
LFQSKNMDLLQETATACPSTNPSLRQSRIQGW