Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YGR146C-A  from Saccharomyces cerevisiae S288C
>YGR146C-A|YGR146C-A YGR146C-A SGDID:S000028638, Chr VII from 785437-785276, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" ORGANISM: Saccharomyces cerevisiae S288C (53 aa)
MGFLPECNLTCAFLLHSFTFPIAHCPSFSWASFFFTIRPPFFPKLALVCTIFS