Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR105W  from Saccharomyces cerevisiae S288C
>YGR105W|YGR105W VMA21 SGDID:S000003337, Chr VII from 698599-698832, Genome Release 64-1-1, Verified ORF, "Integral membrane protein that is required for vacuolar H+-ATPase (V-ATPase) function, although not an actual component of the V-ATPase complex; functions in the assembly of the V-ATPase; localized to the yeast endoplasmic reticulum (ER)" ORGANISM: Saccharomyces cerevisiae S288C (77 aa)
MAVDVPRAVINKLMLFTAAMVVLPVLTFFIIQQFTPNTLISGGLAAAMANVVLIVYIVVA
FREDTEDHKVDGNKKED