Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR102C  from Saccharomyces cerevisiae S288C
>YGR102C|YGR102C GTF1 SGDID:S000003334, Chr VII from 695135-694584, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the trimeric GatFAB AmidoTransferase(AdT) complex; involved in the formation of Q-tRNAQ; transposon insertion mutant is salt sensitive and null mutant has growth defects; non-tagged protein is detected in purified mitochondria" ORGANISM: Saccharomyces cerevisiae S288C (183 aa)
MYKTWRLCRTHTVGGLCHDGSHRFVSTGGAKIGKKFENMNQIRDYLSRPVWSVHEYLGIN
TKEEKLEPPSAEAVKKLLRLSGLPLEGADIKEIQMRLAKQLSFINKLHNIPVEGEKHTKE
YDARLVQRNTKQLNYTKLLEGISHQKQDAELGEVSGSWKATGLAAESKNAYFVVKEGLLK
NRK