Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR095C  from Saccharomyces cerevisiae S288C
>YGR095C|YGR095C RRP46 SGDID:S000003327, Chr VII from 676342-675671, Genome Release 64-1-1, reverse complement, Verified ORF, "Exosome non-catalytic core component; involved in 3'-5' RNA processing and degradation in both the nucleus and the cytoplasm; has similarity to E. coli RNase PH and to human hRrp46p (EXOSC5)" ORGANISM: Saccharomyces cerevisiae S288C (223 aa)
MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVAT
TREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLAL
VDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLL
DSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLVV