Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR074W  from Saccharomyces cerevisiae S288C
>YGR074W|YGR074W SMD1 SGDID:S000003306, Chr VII from 635712-636152, Genome Release 64-1-1, Verified ORF, "Core Sm protein Sm D1; part of heteroheptameric complex (with Smb1p, Smd2p, Smd3p, Sme1p, Smx3p, and Smx2p) that is part of the spliceosomal U1, U2, U4, and U5 snRNPs; homolog of human Sm D1" ORGANISM: Saccharomyces cerevisiae S288C (146 aa)
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPQPRLNKLNSNGI
AMASLYLTGGQQPTASDNIASLQYINIRGNTIRQIILPDSLNLDSLLVDQKQLNSLRRSG
QIANDPSKKRRRDFGAPANKRPRRGL