Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR063C  from Saccharomyces cerevisiae S288C
>YGR063C|YGR063C SPT4 SGDID:S000003295, Chr VII from 617824-617516, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein involved in the regulating Pol I and Pol II transcription, pre-mRNA processing, kinetochore function, and gene silencing; forms a complex with Spt5p" ORGANISM: Saccharomyces cerevisiae S288C (102 aa)
MSSERACMLCGIVQTTNEFNRDGCPNCQGIFEEAGVSTMECTSPSFEGLVGMCKPTKSWV
AKWLSVDHSIAGMYAIKVDGRLPAEVVELLPHYKPRDGSQVE