Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR049W  from Saccharomyces cerevisiae S288C
>YGR049W|YGR049W SCM4 SGDID:S000003281, Chr VII from 591314-591877, Genome Release 64-1-1, Verified ORF, "Potential regulatory effector of CDC4 function, suppresses a temperature-sensitive allele of CDC4, tripartite protein structure in which a charged region separates two uncharged domains, not essential for mitosis or meiosis" ORGANISM: Saccharomyces cerevisiae S288C (187 aa)
MQVSPAIVKGIAVSSLGLYAGILTSSTVISITTPINVLTQHLKNVLCTLGCWSTVLGGLA
TGAFGLSYYLAAPGERPNYLLCGLGVAPLSAAYLYLVSLFNHKLAPKCTRDQNDLEKQKD
EKLPQHHPEVKDGEAACPFSKMNNAKTLKPESERSVKCHSYMSLHMSIVTGITIFTFGKC
ILDGFKA