Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR038W  from Saccharomyces cerevisiae S288C
>YGR038W|YGR038W ORM1 SGDID:S000003270, Chr VII from 560682-561350, Genome Release 64-1-1, Verified ORF, "Evolutionarily conserved protein, similar to Orm2p, required for resistance to agents that induce unfolded protein response; Orm1p and Orm2p together control membrane biogenesis by coordinating lipid homeostasis with protein quality control" ORGANISM: Saccharomyces cerevisiae S288C (222 aa)
MTELDYQGTAEAASTSYSRNQTDLKPFPSAGSASSSIKTTEPVKDHRRRRSSSIISHVEP
ETFEDENDQQLLPNMNATWVDQRGAWIIHVVIIILLKLFYNLFPGVTTEWSWTLTNMTYV
IGSYVMFHLIKGTPFDFNGGAYDNLTMWEQIDDETLYTPSRKFLISVPIALFLVSTHYAH
YDLKLFSWNCFLTTFGAVVPKLPVTHRLRISIPGITGRAQIS