Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR035C  from Saccharomyces cerevisiae S288C
>YGR035C|YGR035C YGR035C SGDID:S000003267, Chr VII from 557422-557072, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function, potential Cdc28p substrate; transcription is activated by paralogous transcription factors Yrm1p and Yrr1p along with genes involved in multidrug resistance" ORGANISM: Saccharomyces cerevisiae S288C (116 aa)
MLLTPAKTTRTEDSANSTDDSSKSSNSFMRAIVSSLMVKPITSLTNTVTCRQSSHHNSSP
SKITRYDLIKAAAENDLKRSKSQGREKSRRNSNRRNNEEIFVANTASEIQRTKSSI