Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR034W  from Saccharomyces cerevisiae S288C
>YGR034W|YGR034W RPL26B SGDID:S000003266, Chr VII from 555812-555830,556308-556672, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl26Ap and has similarity to E. coli L24 and rat L26 ribosomal proteins; binds to 5.8S rRNA" ORGANISM: Saccharomyces cerevisiae S288C (127 aa)
MAKQSLDVSSDRRKARKAYFTAPSSERRVLLSAPLSKELRAQYGIKALPIRRDDEVLVVR
GSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHPSKLVITKLHLDKDRKALIQ
RKGGKLE