Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR033C  from Saccharomyces cerevisiae S288C
>YGR033C|YGR033C TIM21 SGDID:S000003265, Chr VII from 554967-554248, Genome Release 64-1-1, reverse complement, Verified ORF, "Nonessential subunit of the Translocase of the Inner Mitochondrial membrane (TIM23 complex); interacts with the Translocase of the Outer Mitochondrial membrane (TOM complex) and with respiratory enzymes; may regulate TIM23 complex activity" ORGANISM: Saccharomyces cerevisiae S288C (239 aa)
MSSSLPRSLLRLGHRKPLFPRYNTFVNSSVITHTSLLRTRLYSNGTGATSGKKDDKTRNK
PKPLWPQVKSASTFTFSGILVIGAVGISAIVIYLILSELFSPSGDTQLFNRAVSMVEKNK
DIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKK
KIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSNSKGFLGIRWGPRKD