Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR031C-A  from Saccharomyces cerevisiae S288C
>YGR031C-A|YGR031C-A NAG1 SGDID:S000028636, Chr VII from 547300-546809, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein involved in yeast cell wall biogenesis; localizes to the cell periphery; production of Nag1p is dependent upon the presence of Slt2p and Rlm1p; gene is nested within and antisense to IMO32" ORGANISM: Saccharomyces cerevisiae S288C (163 aa)
MNSAGRVHRSRAGSRGHAAISPLTMASFSVARGIRSSNVYDDTDDELSILTFFSAVRRNR
LTSSLPPILSARCSSACFSVRIVLPLSLTISISALMYSTNSALGRKLTGAFSIQTNIEQS
CGFFRTSIMATLPPIECPIIIGPPLVFNSCFVIKCFTSSDMTS