Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGR008C  from Saccharomyces cerevisiae S288C
>YGR008C|YGR008C STF2 SGDID:S000003240, Chr VII from 508364-508110, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein involved in regulation of the mitochondrial F1F0-ATP synthase; Stf1p and Stf2p may act as stabilizing factors that enhance inhibitory action of the Inh1p protein" ORGANISM: Saccharomyces cerevisiae S288C (84 aa)
MTRTNKWTEREGKADPKYFSHTGNYGESPNHIKKQGSGKGNWGKPGDEIDDLIDNGEIPP
VFKKDRRGSNLQSHEQKFENVQKE