Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL261C  from Saccharomyces cerevisiae S288C
>YGL261C|YGL261C PAU11 SGDID:S000003230, Chr VII from 6652-6290, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function and member of the seripauperin multigene family encoded mainly in subtelomeric regions; mRNA expression appears to be regulated by SUT1 and UPC2" ORGANISM: Saccharomyces cerevisiae S288C (120 aa)
MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTE
TYPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIAN