Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL260W  from Saccharomyces cerevisiae S288C
>YGL260W|YGL260W YGL260W SGDID:S000003229, Chr VII from 6860-7090, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; transcription is significantly increased in a NAP1 deletion background; deletion mutant has increased accumulation of nickel and selenium" ORGANISM: Saccharomyces cerevisiae S288C (76 aa)
MEMLLFLNESYIFHRLRMWSIVLWHSCVFVCAECGNANYRVPRCLIKPFSVPVTFPFSVK
KNIRILDLDPRTEAYC