Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL231C  from Saccharomyces cerevisiae S288C
>YGL231C|YGL231C EMC4 SGDID:S000003200, Chr VII from 63620-63048, Genome Release 64-1-1, reverse complement, Verified ORF, "Member of a transmembrane complex required for efficient folding of proteins in the ER; null mutant displays induction of the unfolded protein response; human ortholog TMEM85 may function in apoptosis" ORGANISM: Saccharomyces cerevisiae S288C (190 aa)
MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLA
QKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFST
RSAFKPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAH
YNNGLQWFSD